PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G32370.1
Common NameHDG3, HDGL2-3, T32F6.11, UCL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 725aa    MW: 80070.3 Da    PI: 6.5098
Description homeodomain GLABROUS 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G32370.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.89.3e-1969124156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  ++k  ++t+ q+ e+e++F+++++p+ ++r +L+++lgL+  q+k+WFqN+R++ k
  AT2G32370.1  69 KKKYNRHTQLQISEMEAFFRECPHPDDKQRYDLSAQLGLDPVQIKFWFQNKRTQNK 124
                  789999***********************************************998 PP

2START158.45.7e-502534722206
                  HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEEC CS
        START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevis 86 
                  la  a++el+ +a+++ep+W+         +n de+ ++f ++ +     +++ea+r++++v m+++  ve l++ +  W++++a    +a t+e+i+
  AT2G32370.1 253 LAFGAMEELLVMAQVAEPLWMGGFngtsLALNLDEYEKTFRTGLGprlggFRTEASRETALVAMCPTGIVEMLMQEN-LWSTMFAgivgRARTHEQIM 349
                  78899****************8777776679999999999777669999****************************.******************** PP

                  TT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX CS
        START  87 sg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlp 177
                   +      g lq m+ae+q+lsplv  R+++fvRy++q+g+g w++vd+S+d+  ++ +     +++++pSg+li+++  g+skvtwvehv+++++  
  AT2G32370.1 350 ADaagnfnGNLQIMSAEYQVLSPLVTtRESYFVRYCKQQGEGLWAVVDISIDHLLPNIN----LKCRRRPSGCLIQEMHSGYSKVTWVEHVEVDDAGS 443
                  *********************************************************97....99999****************************** PP

                  HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 178 hwllrslvksglaegaktwvatlqrqcek 206
                   ++++ l+ +g+a++a++wv tl rqce+
  AT2G32370.1 444 YSIFEKLICTGQAFAANRWVGTLVRQCER 472
                  ***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.71E-1848127IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.3E-2052128IPR009057Homeodomain-like
PROSITE profilePS5007116.16366126IPR001356Homeobox domain
SMARTSM003892.4E-1768130IPR001356Homeobox domain
CDDcd000866.91E-1769127No hitNo description
PfamPF000462.6E-1669124IPR001356Homeobox domain
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PROSITE profilePS5084832.273243475IPR002913START domain
CDDcd088751.23E-113247471No hitNo description
SuperFamilySSF559612.09E-26248474No hitNo description
SMARTSM002341.3E-38252472IPR002913START domain
PfamPF018527.7E-41253472IPR002913START domain
Gene3DG3DSA:3.30.530.202.8E-5342454IPR023393START-like domain
SuperFamilySSF559618.63E-16495717No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007131developmental stageseedling development stage
Sequence ? help Back to Top
Protein Sequence    Length: 725 aa     Download sequence    Send to blast
MSQSNMVPVA NNGDNNNDNE NNNNNNNNGG TDNTNAGNDS GDQDFDSGNT SSGNHGEGLG  60
NNQAPRHKKK KYNRHTQLQI SEMEAFFREC PHPDDKQRYD LSAQLGLDPV QIKFWFQNKR  120
TQNKNQQERF ENSELRNLNN HLRSENQRLR EAIHQALCPK CGGQTAIGEM TFEEHHLRIL  180
NARLTEEIKQ LSVTAEKISR LTGIPVRSHP RVSPPNPPPN FEFGMGSKGN VGNHSRETTG  240
PADANTKPII MELAFGAMEE LLVMAQVAEP LWMGGFNGTS LALNLDEYEK TFRTGLGPRL  300
GGFRTEASRE TALVAMCPTG IVEMLMQENL WSTMFAGIVG RARTHEQIMA DAAGNFNGNL  360
QIMSAEYQVL SPLVTTRESY FVRYCKQQGE GLWAVVDISI DHLLPNINLK CRRRPSGCLI  420
QEMHSGYSKV TWVEHVEVDD AGSYSIFEKL ICTGQAFAAN RWVGTLVRQC ERISSILSTD  480
FQSVDSGDHI TLTNHGKMSM LKIAERIART FFAGMTNATG STIFSGVEGE DIRVMTMKSV  540
NDPGKPPGVI ICAATSFWLP APPNTVFDFL REATHRHNWD VLCNGEMMHK IAEITNGIDK  600
RNCASLLRHG HTSKSKMMIV QETSTDPTAS FVLYAPVDMT SMDITLHGGG DPDFVVILPS  660
GFAIFPDGTG KPGGKEGGSL LTISFQMLVE SGPEARLSVS SVATTENLIR TTVRRIKDLF  720
PCQTA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.380830.0silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865047420.0
Genevisible266386_at0.0
Expression AtlasAT2G32370-
AtGenExpressAT2G32370-
ATTED-IIAT2G32370-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in siliques. {ECO:0000269|PubMed:16778018, ECO:0000269|Ref.1}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeobox-leucine zipper family protein belonging to the HD-ZIP IV family. Together with ATML1 and PDF2, it is involved in cotyledon development.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G32370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G32370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF9886350.0EF988635.1 Arabidopsis thaliana homeodomain-leucine zipper protein (HDG3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180796.20.0homeobox-leucine zipper protein HDG3
SwissprotQ9ZV650.0HDG3_ARATH; Homeobox-leucine zipper protein HDG3
TrEMBLR0HIB70.0R0HIB7_9BRAS; Uncharacterized protein
STRINGAT2G32370.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Representative plantOGRP14515136
Publications ? help Back to Top
  1. Tavares R,Aubourg S,Lecharny A,Kreis M
    Organization and structural evolution of four multigene families in Arabidopsis thaliana: AtLCAD, AtLGT, AtMYST and AtHD-GL2.
    Plant Mol. Biol., 2000. 42(5): p. 703-17
    [PMID:10809443]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Schrick K,Nguyen D,Karlowski WM,Mayer KF
    START lipid/sterol-binding domains are amplified in plants and are predominantly associated with homeodomain transcription factors.
    Genome Biol., 2004. 5(6): p. R41
    [PMID:15186492]
  4. Nakamura M, et al.
    Characterization of the class IV homeodomain-Leucine Zipper gene family in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1363-75
    [PMID:16778018]
  5. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  6. Kawanabe T,Fujimoto R,Sasaki T,Taylor JM,Dennis ES
    A comparison of transcriptome and epigenetic status between closely related species in the genus Arabidopsis.
    Gene, 2012. 506(2): p. 301-9
    [PMID:22796129]